Scaffold Ga0373958_0098081

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0373958_0098081

Scaffold Ga0373958_0098081

Overview

Basic Information
Taxon OID	3300034819 Open in IMG/M
Scaffold ID	Ga0373958_0098081 Open in IMG/M
Source Dataset Name	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	684
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil → Populus Rhizosphere Microbial Communities From Soil In West Virginia And Oregon, United States

Source Dataset Sampling Location
Location Name	USA: West Virginia, United States
Coordinates	Lat. (^o)	39.6589	Long. (^o)	-79.9058	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F072898	Metagenome	120	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0373958_0098081_78_236	F072898	AGAAG	VYFSQIFSSLDISQTGTDIENPYGDNIHDMDENNIPEYRTDPTVEGGVIVVG

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.