Scaffold Ga0373950_0061416

Overview

Basic Information

• Taxon OID: 3300034818
• Scaffold ID: Ga0373950_0061416
• Source Dataset Name: Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 755
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil → Populus Rhizosphere Microbial Communities From Soil In West Virginia And Oregon, United States

Source Dataset Sampling Location

• Location Name: USA: West Virginia, United States
• Coordinates
  • Lat. (^o): 39.6589
  • Long. (^o): -79.9058
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F033571	Metagenome	177	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0373950_0061416_423_755	F033571	N/A	HGFFTLEQWRRPQAGAEPQWIAVLHLDSYQSLTKAMTALEKRGQPGLYRIVQTQRCVWAEMEKGKLRLHGSHASSPESLAQLAELFEREGGRRPVEKARQARLQAKASRR