Basic Information | |
---|---|
Taxon OID | 3300034759 Open in IMG/M |
Scaffold ID | Ga0310139_014610 Open in IMG/M |
Source Dataset Name | Fracking water microbial communities from deep shales in Oklahoma, United States - M2-7-4 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1923 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Paenibacillus → Paenibacillus odorifer | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Oklahoma | |||||||
Coordinates | Lat. (o) | 35.784 | Long. (o) | -98.26 | Alt. (m) | Depth (m) | 2896 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F038199 | Metagenome | 166 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0310139_014610_867_1121 | F038199 | GAGG | MEYTQAEFLQIIQQYNSTDRRVIKTNLKRIMNIYNIKPADIAALGYTSRNVYAWTNKSTKNIPLFEQALRISTRFNFNITEFLK |
⦗Top⦘ |