Scaffold Ga0325421_016828

Overview

Basic Information

• Taxon OID: 3300034689
• Scaffold ID: Ga0325421_016828
• Source Dataset Name: Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-PdIQD-R2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 6293
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (42.86%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus alba (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Leaf → Understanding The Reciprocal Impacts Of Modified Plant Cell Wall And Associated Microbiome

Source Dataset Sampling Location

• Location Name: USA: Georgia
• Coordinates
  • Lat. (^o): 32.1348
  • Long. (^o): -81.9657

Associated Families

Family	Category	Number of Sequences	3D Structure?
F094627	Metagenome	105	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0325421_016828_6047_6223	F094627	GAGG	MLEGNEGSEACSKGNEGSRAHLKEGRIENALPLMVKGSKAHSKRNEVRARRRTQVEVG