Basic Information | |
---|---|
Taxon OID | 3300034656 Open in IMG/M |
Scaffold ID | Ga0326748_029647 Open in IMG/M |
Source Dataset Name | Seawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 502_2477 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 750 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Marine Group I → Marine Group I thaumarchaeote | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Filtered Seawater → Extreme Environments Viral Communities From Various Locations |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Atlantic Ocean | |||||||
Coordinates | Lat. (o) | 13.3325 | Long. (o) | -44.9106 | Alt. (m) | Depth (m) | 2477 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F097125 | Metagenome / Metatranscriptome | 104 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0326748_029647_3_149 | F097125 | N/A | KGKIALNNVTILLNEKNDLMHRLEKNKILSEHYSEVLKKNLPNGEDKK |
⦗Top⦘ |