Scaffold Ga0316598_141252

Overview

Basic Information

• Taxon OID: 3300034652
• Scaffold ID: Ga0316598_141252
• Source Dataset Name: Metatranscriptome of peat soil microbial communities from wetland fen in Alaska, United States - Frozen_pond_02R_16 (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 676
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil → Peat Soil Microbial Communities From Wetland Fen In Alaska, United States

Source Dataset Sampling Location

• Location Name: USA: Alaska
• Coordinates
  • Lat. (^o): 64.9142
  • Long. (^o): -147.835
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F059671	Metagenome / Metatranscriptome	133	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0316598_141252_98_583	F059671	N/A	MGLFNSGKNDKVEKVSKYERHYNVPPNSSHRRSSKHRSNQAEPAVRAMSQPPLMRMGAGYYPQANMFTPAAVGGMVPNLMPQVRYQMPPMDLSKYQSPNAFSSNLFAAGQMPQMSLAPMWGNGMAFANNRSTFQQPMNDFQQGGWPLMAPSNNGYMPPMQF