Basic Information | |
---|---|
Taxon OID | 3300034629 Open in IMG/M |
Scaffold ID | Ga0326756_045061 Open in IMG/M |
Source Dataset Name | Seawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 543_2600 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 544 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Filtered Seawater → Extreme Environments Viral Communities From Various Locations |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Atlantic Ocean | |||||||
Coordinates | Lat. (o) | 14.7528 | Long. (o) | -44.9788 | Alt. (m) | Depth (m) | 2600 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F047901 | Metagenome / Metatranscriptome | 149 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0326756_045061_107_373 | F047901 | N/A | MKHYRIRVIAQGCLYIETIEAEDIHAACKILIKKAADGLLKKKETVGFYQRKQVQITYEEVADGASSTSTEQVRSGTSMGQESFDIAT |
⦗Top⦘ |