Scaffold Ga0326755_001666

Overview

Basic Information

• Taxon OID: 3300034628
• Scaffold ID: Ga0326755_001666
• Source Dataset Name: Seawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 543_2961
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2559
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (62.50%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Filtered Seawater → Extreme Environments Viral Communities From Various Locations

Source Dataset Sampling Location

• Location Name: Atlantic Ocean
• Coordinates
  • Lat. (^o): 14.7528
  • Long. (^o): -44.9788
  • Depth (m): 2961

Associated Families

Family	Category	Number of Sequences	3D Structure?
F067127	Metagenome	126	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0326755_001666_1924_2112	F067127	N/A	MKTIWLLYILVYFNGEPRLETYEYNTEQKCEQEKARVIQEVKEVYDIRDVQVHCIRSARALK