Scaffold Ga0310143_07538

Overview

Basic Information

• Taxon OID: 3300034523
• Scaffold ID: Ga0310143_07538
• Source Dataset Name: Fracking water microbial communities from deep shales in Oklahoma, United States - K-4-A
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1391
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa

Source Dataset Sampling Location

• Location Name: USA: Oklahoma
• Coordinates
  • Lat. (^o): 35.812
  • Long. (^o): -98.262
  • Depth (m): 2943

Associated Families

Family	Category	Number of Sequences	3D Structure?
F043476	Metagenome	156	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0310143_07538_127_561	F043476	AGGAGG	VLTLPTNIDRSEIEAFVNHVTAEVMDGNVDPLSVHIRCKAVVKALEAIIERTEELAKDTAATYGKGEFKFHGASVQLREPRDMPDFTQDPVCVELADRLKARHELVKTAFKMASTAAIVDPNTGEVVPVVPVKPAKTTLTVTFR