NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0370540_00389

Scaffold Ga0370540_00389


Overview

Basic Information
Taxon OID3300034448 Open in IMG/M
Scaffold IDGa0370540_00389 Open in IMG/M
Source Dataset NameMetatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_115 (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1495
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From The East River Watershed Near Crested Butte, Colorado, United States

Source Dataset Sampling Location
Location NameUSA: Colorado
CoordinatesLat. (o)38.9206Long. (o)-106.9489Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006238Metagenome / Metatranscriptome378Y
F018340Metagenome / Metatranscriptome235Y

Sequences

Protein IDFamilyRBSSequence
Ga0370540_00389_105_377F006238AGGAGGMIDGCPEPDVEFDASQFATAHKQRQDGCFCYPAPLDDLLSDEIMASVLRSAGYEPDEFREMMTEMAWNLIIPFTGEGDEDVSATKVRGQS
Ga0370540_00389_2_139F018340AGGAGMLVRLKLEDSREGLVATISQRDKDGKITGRPSIFLVWGQGRGKRKG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.