Basic Information | |
---|---|
Taxon OID | 3300034389 Open in IMG/M |
Scaffold ID | Ga0325419_049124 Open in IMG/M |
Source Dataset Name | Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-Control-R4 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2493 |
Total Scaffold Genes | 5 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (40.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Leaf → Understanding The Reciprocal Impacts Of Modified Plant Cell Wall And Associated Microbiome |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Georgia | |||||||
Coordinates | Lat. (o) | 32.1348 | Long. (o) | -81.9657 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F096309 | Metagenome | 104 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0325419_049124_2300_2413 | F096309 | N/A | MFDSLKLFSSTHVTSTDPIAPKSIDFRVLGVKTPLGA |
⦗Top⦘ |