Scaffold Ga0325419_048930

Overview

Basic Information

• Taxon OID: 3300034389
• Scaffold ID: Ga0325419_048930
• Source Dataset Name: Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-Control-R4
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2509
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Leaf → Understanding The Reciprocal Impacts Of Modified Plant Cell Wall And Associated Microbiome

Source Dataset Sampling Location

• Location Name: USA: Georgia
• Coordinates
  • Lat. (^o): 32.1348
  • Long. (^o): -81.9657

Associated Families

Family	Category	Number of Sequences	3D Structure?
F087988	Metagenome	109	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0325419_048930_435_644	F087988	N/A	MMWSHPQNIEYEVSNNYKVVCLWFTKSSTSTVELNLELKSEANDIRISPNFTYNVISSPIHRKLSFNWF