Scaffold Ga0372946_0049756

Overview

Basic Information

• Taxon OID: 3300034384
• Scaffold ID: Ga0372946_0049756
• Source Dataset Name: Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_KNG_2.2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1897
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (40.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Aquabacterium → Aquabacterium soli (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From Eldorado National Forest, California, Usa

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 38.9738
  • Long. (^o): -120.4934
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F018568	Metagenome	234	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0372946_0049756_1158_1424	F018568	AGGA	MATRQIAAQKERKAKTVSKETEAIDLQSDLQSVRVWRPKNVSTTVNGVDDIDVRDGSLLLLKRHANGRETCMVVFSPGQWITANVEPG