Scaffold Ga0326787_046691

Overview

Basic Information

• Taxon OID: 3300034363
• Scaffold ID: Ga0326787_046691
• Source Dataset Name: Metatranscriptome of soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - S96 (Eukaryote Community Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 621
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Experimental Microcosm In Duke University, North Carolina, United States

Source Dataset Sampling Location

• Location Name: USA: North Carolina
• Coordinates
  • Lat. (^o): 36.0
  • Long. (^o): -78.0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F085198	Metagenome / Metatranscriptome	111	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0326787_046691_41_619	F085198	N/A	LRPSGWTILCVFGTTTVETTVLLANTGETTELTVFVDGVHDPVDFGVSANGFVGGIDEDNFVIFVGGVLHNPVGAQDTQVTSTTANSLLRNRSMRALEFELVDTSTSGFTVVNTLGQRLLAPSSSNTDTVDHVTLLRLVAKTASLVRSSGVGDTVNGREISVFPASKPEQSPQDVRLLLLVKFLKIFVGTHCS