NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0372943_0439058

Scaffold Ga0372943_0439058


Overview

Basic Information
Taxon OID3300034268 Open in IMG/M
Scaffold IDGa0372943_0439058 Open in IMG/M
Source Dataset NameForest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)846
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From Eldorado National Forest, California, Usa

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)38.7833Long. (o)-120.2976Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F032127Metagenome180Y

Sequences

Protein IDFamilyRBSSequence
Ga0372943_0439058_314_652F032127N/AMTIDEALLALNDRLGQEVTAWVELDHEKPLLIATGVLDNWSRETLADALPKEEPAHFDLRGHYSIGDARFDLSDAPVESVGDHVGGNGLVFRLAGGARLVVTWVPLPEEDLV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.