Basic Information | |
---|---|
Taxon OID | 3300034268 Open in IMG/M |
Scaffold ID | Ga0372943_0000063 Open in IMG/M |
Source Dataset Name | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 41557 |
Total Scaffold Genes | 57 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 40 (70.18%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From Eldorado National Forest, California, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: California | |||||||
Coordinates | Lat. (o) | 38.7833 | Long. (o) | -120.2976 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F030216 | Metagenome / Metatranscriptome | 186 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0372943_0000063_22272_22550 | F030216 | GAGG | MPGSISLEQRLEGHVPAPSGRRVTRASFRRAPGGLRQRIDASIEDAVRIFELDRLLYDIEVDAQHAWLRRLMAFDAYCAGRDGGGPPDPPVR |
⦗Top⦘ |