Scaffold Ga0370495_0144803

Overview

Basic Information

• Taxon OID: 3300034257
• Scaffold ID: Ga0370495_0144803
• Source Dataset Name: Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_17
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 752
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil → Peat Soil Microbial Communities From Wetland Fen In Alaska, United States

Source Dataset Sampling Location

• Location Name: USA: Alaska
• Coordinates
  • Lat. (^o): 64.9142
  • Long. (^o): -147.835
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F050633	Metagenome / Metatranscriptome	145	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0370495_0144803_6_269	F050633	N/A	MNKPTLRLMIQEKLADGRLPHNYIPRVGGGLGTGEICDGCGETVTKTQVVMEGLSGEDRGVKFHVACFYVWDATRQVFGYKPSGPAD