NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0370514_129206

Scaffold Ga0370514_129206


Overview

Basic Information
Taxon OID3300034199 Open in IMG/M
Scaffold IDGa0370514_129206 Open in IMG/M
Source Dataset NamePeat soil microbial communities from wetlands in Alaska, United States - Goldstream_01D_14
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)649
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil → Peat Soil Microbial Communities From Wetland Fen In Alaska, United States

Source Dataset Sampling Location
Location NameUSA: Alaska
CoordinatesLat. (o)64.9123Long. (o)-147.839Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F017528Metagenome / Metatranscriptome240Y

Sequences

Protein IDFamilyRBSSequence
Ga0370514_129206_1_210F017528AGGAMPAEPGARRFRVGHVPPLAEGFTERSDTARGIVDALVPGASVALVPGSAFAEGPQNWLGACGKTQIAVII

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.