Scaffold Ga0364932_0372154

Overview

Basic Information

• Taxon OID: 3300034177
• Scaffold ID: Ga0364932_0372154
• Source Dataset Name: Sediment microbial communities from East River floodplain, Colorado, United States - 17_j17
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 539
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → Flavobacterium enshiense (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment → Sediment Microbial Communities From Colorado River Basin Floodplains, Colorado, United States

Source Dataset Sampling Location

• Location Name: USA: Colorado
• Coordinates
  • Lat. (^o): 38.9229
  • Long. (^o): -106.9499

Associated Families

Family	Category	Number of Sequences	3D Structure?
F057161	Metagenome	136	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0364932_0372154_121_318	F057161	N/A	MGAAAANAATGAGLTVMVLVCVIVLAQTSVNVQVSVTVPPHAVGRALNVDVTDPLIRHVPLALFV