Scaffold Ga0334925_097431

Overview

Basic Information

• Taxon OID: 3300034173
• Scaffold ID: Ga0334925_097431
• Source Dataset Name: Biocrust microbial communities from Mojave Desert, California, United States - 21HNC
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 634
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → unclassified Rubrobacteraceae → Rubrobacteraceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Hypolithic Biocrust → Soil And Biocrust Microbial Communities From Mojave Desert, California, United States

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 34.7856
  • Long. (^o): -115.66

Associated Families

Family	Category	Number of Sequences	3D Structure?
F034698	Metagenome	174	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0334925_097431_248_454	F034698	N/A	MEVGDVRVGMRVRVTDRHRIAERRGLIGKVVGRYGGDDHVVVDVRFPDGRQLLFWPQDLEGISSPRPW