Basic Information | |
---|---|
Taxon OID | 3300034170 Open in IMG/M |
Scaffold ID | Ga0370487_0243991 Open in IMG/M |
Source Dataset Name | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_03D_16 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 602 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Propionibacteriaceae → unclassified Propionibacteriaceae → Propionibacteriaceae bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil → Peat Soil Microbial Communities From Wetland Fen In Alaska, United States |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Alaska | |||||||
Coordinates | Lat. (o) | 64.9141 | Long. (o) | -147.8344 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F097269 | Metagenome | 104 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0370487_0243991_145_393 | F097269 | GAG | MSVATGTVRSMSSRTRSSLGSLGDRVRRPATAFCLVDGAAPGLVMEWLRVADTWSARVAYLDDGALIVSILPADRLEKASVS |
⦗Top⦘ |