NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0364929_0121131

Scaffold Ga0364929_0121131


Overview

Basic Information
Taxon OID3300034149 Open in IMG/M
Scaffold IDGa0364929_0121131 Open in IMG/M
Source Dataset NameSediment microbial communities from East River floodplain, Colorado, United States - 20_j17
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)836
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment → Sediment Microbial Communities From Colorado River Basin Floodplains, Colorado, United States

Source Dataset Sampling Location
Location NameUSA: Colorado
CoordinatesLat. (o)38.9229Long. (o)-106.9499Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F061825Metagenome / Metatranscriptome131Y
F080672Metagenome / Metatranscriptome115Y

Sequences

Protein IDFamilyRBSSequence
Ga0364929_0121131_550_696F080672GGAMESLRMGHCMLTLARFSLGRVVLHLLAMIGDGAFRFHAAGILRELVSR
Ga0364929_0121131_698_835F061825N/AMTYLTHEQQIFVLQQIRNWVCGRHMVFNALNAAWATHGAEAYFWN

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.