Scaffold Ga0334958_122782

Overview

Basic Information

• Taxon OID: 3300034141
• Scaffold ID: Ga0334958_122782
• Source Dataset Name: Biocrust microbial communities from Mojave Desert, California, United States - 54SNC
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 558
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Chroococcales → Aphanothecaceae → Crocosphaera → Crocosphaera chwakensis (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Biocrust → Soil And Biocrust Microbial Communities From Mojave Desert, California, United States

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 34.3778
  • Long. (^o): -117.6098

Associated Families

Family	Category	Number of Sequences	3D Structure?
F007252	Metagenome / Metatranscriptome	354	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0334958_122782_75_557	F007252	N/A	EKKVKNNSRKLMNNKVHPFFEDVTLWDFNMKKSKGKSKCGRGGARPGAGGGCRWKHGRTKLVRLPVALLHEILEVARYMDQNEGRLPPSAPPVITSGHLSESLSGEELKEFLAKKKARKLAEKVMCGDERWWSAIKPLQLLIFLMFPQPKKLGQAADEIF