Scaffold Ga0334956_044192

Overview

Basic Information

• Taxon OID: 3300034139
• Scaffold ID: Ga0334956_044192
• Source Dataset Name: Biocrust microbial communities from Mojave Desert, California, United States - 52SNC
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 724
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Biocrust → Soil And Biocrust Microbial Communities From Mojave Desert, California, United States

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 34.3778
  • Long. (^o): -117.6098

Associated Families

Family	Category	Number of Sequences	3D Structure?
F008279	Metagenome / Metatranscriptome	336	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0334956_044192_323_724	F008279	N/A	SSPEAKRIERSITTATVIELVASIVFPVLVVAAGHSDWVLPSIAVTIGPLLLWLDHLVDIPRYRAVGWALTIGPFLLVAALSGSALAATTGLAAGTLLLGTATAGFHDLAGERPGRRTGVGPGRRAVPASEAR