NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0334911_008731

Scaffold Ga0334911_008731


Overview

Basic Information
Taxon OID3300034131 Open in IMG/M
Scaffold IDGa0334911_008731 Open in IMG/M
Source Dataset NameSub-biocrust soil microbial communities from Mojave Desert, California, United States - 7HMS
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1353
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil → Soil And Biocrust Microbial Communities From Mojave Desert, California, United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)34.7856Long. (o)-115.66Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F011905Metagenome / Metatranscriptome286Y
F104354Metagenome / Metatranscriptome100Y

Sequences

Protein IDFamilyRBSSequence
Ga0334911_008731_768_977F011905AGGTGGMRIMRIRRRLAQVGLIMVALPLVGWGLEQLARRAEERRPGSGRWLRQGSDLAHGFGRGPLSSRLRSPRP
Ga0334911_008731_986_1351F104354GAGGMRTAPRIGAALVGWRRLAVVAALANTVVLLAYGLTRGDREALAFAVIMLVGLGLLRVGSGLLGLLVLAALFVNIEFWMFPAANGNATYRVGLIDLLVPGSLVAFSLAGFIGAVGGAVHAHDP
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.