NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0364937_007431

Scaffold Ga0364937_007431


Overview

Basic Information
Taxon OID3300034113 Open in IMG/M
Scaffold IDGa0364937_007431 Open in IMG/M
Source Dataset NameSediment microbial communities from East River floodplain, Colorado, United States - 7_s17
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1577
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment → Sediment Microbial Communities From Colorado River Basin Floodplains, Colorado, United States

Source Dataset Sampling Location
Location NameUSA: Colorado
CoordinatesLat. (o)38.9229Long. (o)-106.9499Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F052026Metagenome / Metatranscriptome143N
F085877Metagenome / Metatranscriptome111Y

Sequences

Protein IDFamilyRBSSequence
Ga0364937_007431_1151_1411F052026AGGAGGMSTMAIGVERDQLRLIGSRPGTAGKGPRLYAAERICGASKCRTVLSRYNRTELCWLHEPRHEYLSAVRGRRPAEVEVLDQLVAKVS
Ga0364937_007431_3_164F085877N/AMTSERATATEQRAEDRTRVSRMLEPHAPPDWQQRFRTTELLDSVIDGQPIQMFV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.