NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0335031_0188309

Scaffold Ga0335031_0188309


Overview

Basic Information
Taxon OID3300034104 Open in IMG/M
Scaffold IDGa0335031_0188309 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1405
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.0995Long. (o)-89.4045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F085644Metagenome / Metatranscriptome111Y
F099166Metagenome103N

Sequences

Protein IDFamilyRBSSequence
Ga0335031_0188309_662_862F085644AGGAGMGREDKVGRSTHSIAYIRQMLEWGFDKEFIARDMGVNLSSLEVRLNRAKKREQDDNQRPESETSGN
Ga0335031_0188309_822_1310F099166GGAMTIKDLSLKLAAISLLADQAKRLKDELRAELQGEMNNLGADRVKAELGDEVIAYITTTKPKFKWVIKSDRKFIDWVKTNVPSEIVETVRDSSIDKILEKFNYLDDVVIDPNGEIVDWLEGSESEPYLTTKFHGEGRAKLRDAIIGLNGANEIDVRKVLELEG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.