NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0335029_0007852

Scaffold Ga0335029_0007852


Overview

Basic Information
Taxon OID3300034102 Open in IMG/M
Scaffold IDGa0335029_0007852 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)8336
Total Scaffold Genes26 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)14 (53.85%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Nodensvirus → Synechococcus virus SPM2(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.0995Long. (o)-89.4045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000919Metagenome / Metatranscriptome834Y
F007919Metagenome / Metatranscriptome342Y
F049575Metagenome / Metatranscriptome146Y
F072267Metagenome / Metatranscriptome121Y

Sequences

Protein IDFamilyRBSSequence
Ga0335029_0007852_3067_3600F072267N/AMTEKIGYKLNPKKLQKAPQSVLPYILGCFYFTEDYEYFDVIKPYLDIPEKPKTLEEISREFDEKIDDLIERTKNNFYKSKYIAETLYETKFNRIIENFEYAKEHGQFPQKSILTYSTPLGVNGIASSFIIKQGNKHEGYYTIGNGYLRFYMPYKPNAITRWFMNKCLSIRWVDEKND
Ga0335029_0007852_3584_3796F049575N/AMRKMTKLSAADLMVIHNTLYKSLNVVGNSIWTQETRERVMDKVSIIMENMNAEVVCGDVEPIVVSGDLGG
Ga0335029_0007852_485_745F000919GGAGMRFRNIEFRWSKFNNKYELVKWYQSNGSGQENCYVIAFFDKDKEGYDMRTIGDRFFEDKDAWVVGKYGLEFLNEIFEIERIEEELK
Ga0335029_0007852_6388_6573F007919N/AMTERVKFTQVSRVICPRTGVHYLDAISDKGEHYMAQMETDVEKWITYKKVWYQDPQQPLD
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.