NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0335020_0000395

Scaffold Ga0335020_0000395


Overview

Basic Information
Taxon OID3300034082 Open in IMG/M
Scaffold IDGa0335020_0000395 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)34105
Total Scaffold Genes37 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)26 (70.27%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.0995Long. (o)-89.4045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001360Metagenome / Metatranscriptome714Y
F015212Metagenome / Metatranscriptome256Y

Sequences

Protein IDFamilyRBSSequence
Ga0335020_0000395_23130_23891F001360AGGAGMSLAKFRKVGTKTGSGRFVVSEGIAPAAYLLPSQGLPTWYLDSEDDRFEIVITKGTILSVVADANGDARIVPANGSGSSVTWGDAMPASWDPLNGATPAYSSGATDSVAVASYSVPVGVAQYDLYRPFDKGTSQGAGFIARGYVEYPMVSLVNDDVTVGSLIKADHMGRPVSLTTALCGTNPYLQVGKVIEVEKFATNFDDGLLSYMQLPSDPGALKTVYELTRSGSFSGKLGIRSNLDVNNVIGAFRVNLTL
Ga0335020_0000395_26314_26652F015212AGGAMATQYPASLDNFVNPTSTDRLDSVSVPHHKQHTDINDAVEALQTVIGLNPAGSHLTVKDRIIAAETNISAQSVLNGLTDVTINTAASGQILRYNGSQWVNYAESDLVDGGNF

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.