NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0310127_124160

Scaffold Ga0310127_124160


Overview

Basic Information
Taxon OID3300034072 Open in IMG/M
Scaffold IDGa0310127_124160 Open in IMG/M
Source Dataset NameFracking water microbial communities from deep shales in Oklahoma, United States - MC-3-A
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1064
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa

Source Dataset Sampling Location
Location NameUSA: Oklahoma
CoordinatesLat. (o)35.784Long. (o)-98.26Alt. (m)Depth (m)2896
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000671Metagenome / Metatranscriptome945Y
F011938Metagenome / Metatranscriptome285Y
F013891Metagenome / Metatranscriptome267Y

Sequences

Protein IDFamilyRBSSequence
Ga0310127_124160_399_635F000671GAGGMEKILCYSCNKTKNKLDVKKSTLLPINLLMCETCITSRFEPRWVIILAGRSNGAEFVKEYIQKKRYVGNEVSASELLV
Ga0310127_124160_635_832F011938AGGGGGVKEYYDVIYIVYIHSENCYGTVEKLGAYASVVRYNLHGNELEELLENEDFTIVDEIVHQHVEESN
Ga0310127_124160_816_1040F013891N/AMKKRVHAIPKPALLLMDVVKYPDFLALRLYEDNFIQFDGTKKEIVIDYVSKVKKLIESYGVRCELEGVPSERVL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.