NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0335028_0000265

Scaffold Ga0335028_0000265


Overview

Basic Information
Taxon OID3300034071 Open in IMG/M
Scaffold IDGa0335028_0000265 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)39693
Total Scaffold Genes63 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)54 (85.71%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.0995Long. (o)-89.4045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002301Metagenome / Metatranscriptome573Y
F017468Metagenome / Metatranscriptome240Y
F051089Metagenome / Metatranscriptome144Y

Sequences

Protein IDFamilyRBSSequence
Ga0335028_0000265_23467_24132F002301GGAMAQEYITEYDALVASLAVEYHRRYPMLEVLDIQQVLWLWFLTHTRKYAEWSKLEQKDKDKLIAKSLRNAAITYCEKEKAKTIGYEVLDLYYYDATVIEAFLPSIISETYEMPSKIKDLNFKFNKSEANNDGKNWLVLRSDIATAFYRLSEAKQNILRIKFSTENNEWALIAKDLKTTPDGARMKVQRAINSLIRNLGGWRPFTDNDSPVVEEDEDEPTETH
Ga0335028_0000265_35653_35928F051089AGGMATGTAGSSFTSELNRLGNSGTYPVLTSYLAATGAANQYAGTTGKALIGALNLEADSARQPKDFKALGGICNELAGTTNLSPTDALRSIDV
Ga0335028_0000265_37248_37559F017468AGGAMKHWEHHPEPVEGCFGCKGLSIQMNTGDAHSQRSMPTKAFNKELDAYKEARAQGIQPAGTSMKKIQEAVKASDILGKPYDSSKMAPAKHINKKSAAVLNQLGA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.