NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0334990_0400991

Scaffold Ga0334990_0400991


Overview

Basic Information
Taxon OID3300034068 Open in IMG/M
Scaffold IDGa0334990_0400991 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)739
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.0995Long. (o)-89.4045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F019477Metagenome / Metatranscriptome229Y
F031871Metagenome / Metatranscriptome181Y
F059893Metagenome / Metatranscriptome133Y

Sequences

Protein IDFamilyRBSSequence
Ga0334990_0400991_101_385F031871AGGAGMKQDHTLYIYKADKRTKSGERLLSTTVWRNRDSAEMAREVRELQYQTWPKSQGYRLEFVPTMKTVTNLMSGAEIQIAHDTPRSCDPSSELYWSM
Ga0334990_0400991_447_605F019477AGGAGMGSWTFSEFRIGRMFHLNGCDYVKQSTRTARMLSNGRIFYIGQQERIHAVAW
Ga0334990_0400991_607_738F059893N/ALADKSEIEVYVHEVIRGKAAAHVREVEIRRAVKPVLNTDTRGD

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.