NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0334827_020985

Scaffold Ga0334827_020985


Overview

Basic Information
Taxon OID3300034065 Open in IMG/M
Scaffold IDGa0334827_020985 Open in IMG/M
Source Dataset NamePeat soil microbial communities from Stordalen Mire, Sweden - 714 S1 1-5
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2703
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Kordia(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil → Peatland Microbial Communities From Stordalen Mire, Sweden

Source Dataset Sampling Location
Location NameSweden: Norrbotten County, Stordalen Mire
CoordinatesLat. (o)68.3532Long. (o)19.0475Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F042687Metagenome / Metatranscriptome157Y

Sequences

Protein IDFamilyRBSSequence
Ga0334827_020985_2421_2702F042687GGALKAGGLVVASGAIGSIWAFVTGVSTKGNARKRAMWIRIVDRPTLSEKTSDYKRFSGNDMFALYRPLKTQRDGAGSFEAEQASKAERVAAWIRER

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.