NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0334987_0141698

Scaffold Ga0334987_0141698


Overview

Basic Information
Taxon OID3300034061 Open in IMG/M
Scaffold IDGa0334987_0141698 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1773
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Leptospirillum → Leptospirillum sp. Group II(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.0995Long. (o)-89.4045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001981Metagenome / Metatranscriptome608N
F011215Metagenome / Metatranscriptome293Y
F029089Metagenome / Metatranscriptome189N

Sequences

Protein IDFamilyRBSSequence
Ga0334987_0141698_229_450F011215N/AMNLLEQMNADEFRKLLEFKEKFPLIGLDLVRTLTEKTHPIQLTLGECIDLSNAIGIPYGQYCNQIFGTFISKP
Ga0334987_0141698_447_896F001981N/AMTYPTLITIPKSDICKAEIAQIAQQLTDRINDGEVNPIEAHIKLKAIVKALEATIKATEQTVADEASKHGKTFSAFGAEITLKEGSLTPNYEEDPIYADIKAQLKAREELLKIAFRQAGKTAIFDESTGEQVPVCTAKATKASIAVSFK
Ga0334987_0141698_8_232F029089N/AMAIAQQNLGDLNDKLGLVPSYDELTTATLKADFLALLDKLPKEQAAKFIKDIDHMTPARFEKGIQFIQNQLAKP

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.