NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0334987_0093336

Scaffold Ga0334987_0093336


Overview

Basic Information
Taxon OID3300034061 Open in IMG/M
Scaffold IDGa0334987_0093336 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2337
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.0995Long. (o)-89.4045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F015204Metagenome / Metatranscriptome256Y
F046910Metagenome / Metatranscriptome150Y
F065707Metagenome / Metatranscriptome127Y

Sequences

Protein IDFamilyRBSSequence
Ga0334987_0093336_1766_2107F015204GAGMAQGAKEMTFTEWWEQLTKAERKVIGESNAKFVWEECQKYTLMTIEEACKAQVAYDEGFKQGRERFEIKLAGWTLTPGVQPGMIWISDAGGEGGDFHIHELAEVIGKFYKEKF
Ga0334987_0093336_364_603F046910GGAGMTPSLQDIVEALGPRQLVQVVIITAGGQKFALIGPVIQDPRVHGFEEVTEIEFGELMPMDVAAKMLSGDHKEWLGTGLQ
Ga0334987_0093336_662_910F065707GGAGGMRPAIFSTENPPRPIDCLETKEYIAGLRRRIEVQNDSMEHLASQVHVLLGKIAHLNEEIEKFSLDLAVKNQEVPPGWQEVKP

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.