NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0334946_000002

Scaffold Ga0334946_000002


Overview

Basic Information
Taxon OID3300034026 Open in IMG/M
Scaffold IDGa0334946_000002 Open in IMG/M
Source Dataset NameSub-biocrust soil microbial communities from Mojave Desert, California, United States - 42SMS
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1446930
Total Scaffold Genes1271 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)806 (63.41%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil → Soil And Biocrust Microbial Communities From Mojave Desert, California, United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)34.7856Long. (o)-115.66Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F014784Metagenome / Metatranscriptome260Y
F037412Metagenome / Metatranscriptome168Y
F090844Metagenome / Metatranscriptome108Y

Sequences

Protein IDFamilyRBSSequence
Ga0334946_000002_1031858_1032052F037412GAGMSKDFKCEACRKPAVSLHMRDLDGKWVCANCIPERELDACPGLRERLGLLPRRSNASIQRKKAA
Ga0334946_000002_286062_286310F090844AGGAGMVDNDNQRDSSLNDSSADEGLKPKTAPTATEAVSPSHEQRSLDIGESGQFAPGGYYNQQGITESERIDLDEYTATRTPDDEK
Ga0334946_000002_329806_330564F014784GGAGMNGWIEERAERLREFFEMTASARLVAQDAARFELPPDAAAALSHFNIEWHVIPSAEILPADDAYMARLYPLAPRDFTKAHEHGPSPRDQLTKGHERLQGRVVGVETTAKPRYLPDNRQFYGTTYGHDATADPFAAYMGRAGMMNGTRYAHNYLSLRAFLDVVNEDWRAHHLLPAGYRATVCPPAVFNLVGTIFHPEWSETETLELGFYRDEQGNATCYAVGSNAPGDFSYINEIEGEGDWSLTGFRIALVPE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.