NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0334919_000016

Scaffold Ga0334919_000016


Overview

Basic Information
Taxon OID3300034001 Open in IMG/M
Scaffold IDGa0334919_000016 Open in IMG/M
Source Dataset NameBiocrust microbial communities from Mojave Desert, California, United States - 15HMC
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)231104
Total Scaffold Genes214 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)96 (44.86%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Hypolithic Biocrust → Soil And Biocrust Microbial Communities From Mojave Desert, California, United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)34.7856Long. (o)-115.66Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F029836Metagenome / Metatranscriptome187Y

Sequences

Protein IDFamilyRBSSequence
Ga0334919_000016_75851_76237F029836AGGMKRAKWLPVVAVVAAATLWFATAGRSGAGQSEYSRGGDALLQLKHSPVLGLNIPIAVWIDGMQAGAFTKGHLYERTLTPGRHTLFASRPSRASDSFYGTLDVRPGETYSFVVKCSPNQVHLVPVSRFD

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.