NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0334979_0006191

Scaffold Ga0334979_0006191


Overview

Basic Information
Taxon OID3300033996 Open in IMG/M
Scaffold IDGa0334979_0006191 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)8371
Total Scaffold Genes18 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)15 (83.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.0995Long. (o)-89.4045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001094Metagenome / Metatranscriptome780Y
F006653Metagenome / Metatranscriptome367Y
F085686Metagenome / Metatranscriptome111Y

Sequences

Protein IDFamilyRBSSequence
Ga0334979_0006191_2529_2723F001094AGAAGGMKINAKVKAILATYLRAGVASVIALYLAGVTDPKALATAGIAAIAGPLLKALDPKATEFGRGAK
Ga0334979_0006191_6862_7074F006653GGAMTEETLSNKYRDNIKIEALRTDVDAIKVDLTNFVGALLQSGVVELVKDEEGNVIYKINKVVLVDESVQQD
Ga0334979_0006191_8182_8370F085686GGAGMASNAQSKLLLEAAQRYAQEVSPETLVALDERGISELVAAKFQLGTVTDPLNGHEMYDGWISI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.