Scaffold Ga0334992_0160871

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0334992_0160871

Scaffold Ga0334992_0160871

Overview

Basic Information
Taxon OID	3300033992 Open in IMG/M
Scaffold ID	Ga0334992_0160871 Open in IMG/M
Source Dataset Name	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1147
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States

Source Dataset Sampling Location
Location Name	USA: Wisconsin
Coordinates	Lat. (^o)	43.0995	Long. (^o)	-89.4045	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F054567	Metagenome	139	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0334992_0160871_371_1006	F054567	GGTGG	VEPDLVERMKSGGLSDGYFVYGPSFPVVFREPFSNERHLFSDSQLHCCVPYLELEKKFFDDNAAIVRENYFDADLLLDVDPAEDLAVEEVVDYDDLVPAISVEEIVWQVAAVDHIASIENEETTERVTSPVVVAAGSGLVDAVGEGRAGAPSDPGPSDGSVRVDDFLPGPRPGPVASMTSSDVASDEVILISFFDFLRPFWCLIISVYYCG

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.