Scaffold Ga0334965_0007440

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0334965_0007440

Scaffold Ga0334965_0007440

Overview

Basic Information
Taxon OID	3300033991 Open in IMG/M
Scaffold ID	Ga0334965_0007440 Open in IMG/M
Source Dataset Name	Sediment microbial communities from Lake Vrana, Zadar, Croatia - 4 bact
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	6411
Total Scaffold Genes	12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	11 (91.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment → Extreme Environments Viral Communities From Various Locations

Source Dataset Sampling Location
Location Name	Croatia: Zadar
Coordinates	Lat. (^o)	43.9359	Long. (^o)	15.5428	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F085040	Metagenome	111	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0334965_0007440_4156_4398	F085040	GGA	MAEYLKYGATGVLALIILVVLVPVIRAFVEELKESRRERQEMRKEHNEFVVNHARRTTEALLQVKDGLEQVCRRLNGDER

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.