Basic Information | |
---|---|
Taxon OID | 3300033991 Open in IMG/M |
Scaffold ID | Ga0334965_0000174 Open in IMG/M |
Source Dataset Name | Sediment microbial communities from Lake Vrana, Zadar, Croatia - 4 bact |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 57141 |
Total Scaffold Genes | 79 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 56 (70.89%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Archaea | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment → Extreme Environments Viral Communities From Various Locations |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Croatia: Zadar | |||||||
Coordinates | Lat. (o) | 43.9359 | Long. (o) | 15.5428 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F102093 | Metagenome | 102 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0334965_0000174_17585_17815 | F102093 | N/A | MPARSEHKIMKHGTSGVVVIPKPYRDYHHLKPGSNVTILYDSLLLIVPEGLSGLLTQKAELIDRLLGQKPNKKDAQ |
⦗Top⦘ |