Scaffold Ga0334977_0008492

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0334977_0008492

Scaffold Ga0334977_0008492

Overview

Basic Information
Taxon OID	3300033978 Open in IMG/M
Scaffold ID	Ga0334977_0008492 Open in IMG/M
Source Dataset Name	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	5869
Total Scaffold Genes	15 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	11 (73.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota, Crystal Bog Lake, And Trout Bog Lake In Wisconsin, United States

Source Dataset Sampling Location
Location Name	USA: Wisconsin
Coordinates	Lat. (^o)	43.0995	Long. (^o)	-89.4045	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F082394	Metagenome	113	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0334977_0008492_3202_3522	F082394	GGAGG	MTTEHTIDLDLDWLDDDNSNAIEFAKENHVVGVLTAHWSEESYEDFDQHGNSYPSTVWKLWTWTLEGVLVNGHQMHMPDLPAGITAAFDAHGCEKELMREQPRGTR

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.