Scaffold Ga0314861_0145061

Overview

Basic Information

• Taxon OID: 3300033977
• Scaffold ID: Ga0314861_0145061
• Source Dataset Name: Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1165
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon CG07_land_8_20_14_0_80_47_9 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland → Tropical Peatland Microbial Communities From Different Locations

Source Dataset Sampling Location

• Location Name: Peru: Loreto
• Coordinates
  • Lat. (^o): -4.0712
  • Long. (^o): -73.2029
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F029354	Metagenome	188	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0314861_0145061_381_677	F029354	AGAAGG	MEEFEKKFIKPIVNASYPGTLAALSMAVLQVTGLHGEQTPFPLKFTLLLGAVTFLLSAFSIFFFSIYPTRKKLWTSAAVMFLVGLFCLIASVFLLFIV