Scaffold Ga0314861_0000133

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0314861_0000133

Scaffold Ga0314861_0000133

Overview

Basic Information
Taxon OID	3300033977 Open in IMG/M
Scaffold ID	Ga0314861_0000133 Open in IMG/M
Source Dataset Name	Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	128190
Total Scaffold Genes	114 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	78 (68.42%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland → Tropical Peatland Microbial Communities From Different Locations

Source Dataset Sampling Location
Location Name	Peru: Loreto
Coordinates	Lat. (^o)	-4.0712	Long. (^o)	-73.2029	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F031415	Metagenome / Metatranscriptome	182	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0314861_0000133_6815_7060	F031415	GGAG	MLSHEELEKIREEREVMDTWRTYSRHAVADLLEACAICGTLREKAHLTRCRWCEDTYICKEGVCAQQHQAELHPAVAFWTW

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.