Scaffold Ga0334817_039522

Overview

Basic Information

• Taxon OID: 3300033820
• Scaffold ID: Ga0334817_039522
• Source Dataset Name: Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-2-D
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 941
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil → Peatland Microbial Communities From Stordalen Mire, Sweden

Source Dataset Sampling Location

• Location Name: Sweden: Norrbotten County, Stordalen Mire
• Coordinates
  • Lat. (^o): 68.3533
  • Long. (^o): 19.0466
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F090751	Metagenome / Metatranscriptome	108	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0334817_039522_439_795	F090751	GGA	MAFCLWMELVLDLEGPTSEVVSKELAARYGGFSPALGTVGSKEAVCSLNEWVIEHALAIAGRRPMLAALSFHVNHHPAYHAMRSFALHCHDTWPVEYPDHRPSFEEWREAADAYFEAQ