Scaffold Ga0314867_003668

Overview

Basic Information

• Taxon OID: 3300033808
• Scaffold ID: Ga0314867_003668
• Source Dataset Name: Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_20
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3561
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland → Tropical Peatland Microbial Communities From Different Locations

Source Dataset Sampling Location

• Location Name: Peru: Loreto
• Coordinates
  • Lat. (^o): -6.3272
  • Long. (^o): -74.8136
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F015444	Metagenome / Metatranscriptome	254	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0314867_003668_2855_3157	F015444	AGGAGG	MSSNRELTMSSYVGIGLGLMLIVGIEVVLTYQHLPTRTLLFSLLCLAGFEALVAIMYLMQVKYERPILFWTVFPATLFVLVFLCYIWPDAFRMFNMRLTQ