Scaffold Ga0314863_106334

Overview

Basic Information

• Taxon OID: 3300033804
• Scaffold ID: Ga0314863_106334
• Source Dataset Name: Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_20
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 592
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus → Chthoniobacter flavus Ellin428 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland → Tropical Peatland Microbial Communities From Different Locations

Source Dataset Sampling Location

• Location Name: Peru: Loreto
• Coordinates
  • Lat. (^o): -6.3272
  • Long. (^o): -74.8136
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F061951	Metagenome / Metatranscriptome	131	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0314863_106334_241_486	F061951	N/A	MMEQIFAQRARQLRNAAIALVVIVAAQVVALEVVLRGWQAKNTLSVFAGAGASALLCALALIIFLRTRAKREAAISEPESH