NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0314863_006425

Scaffold Ga0314863_006425


Overview

Basic Information
Taxon OID3300033804 Open in IMG/M
Scaffold IDGa0314863_006425 Open in IMG/M
Source Dataset NameTropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_20
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2374
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon RBG_13_38_9(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland → Tropical Peatland Microbial Communities From Different Locations

Source Dataset Sampling Location
Location NamePeru: Loreto
CoordinatesLat. (o)-6.3272Long. (o)-74.8136Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007903Metagenome / Metatranscriptome342Y
F102350Metagenome / Metatranscriptome101Y

Sequences

Protein IDFamilyRBSSequence
Ga0314863_006425_1859_2080F007903GAGMSTSELEQLIKDFLETKLGVALDHFSIEGRMSPDANGDMGVTGTYRKRSDDRNVFFTVTVNLASRKIQNFQEY
Ga0314863_006425_239_523F102350AGGMDSNSFTYPGGHTESRSPRYFVKVLKVSEPQSVLEWAPIQGRKYVDILDYETARVSGMQIDHLGSGLYIDRRTGKKYDYEEDVKGRRHYFEVSA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.