Scaffold Ga0314858_134835

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0314858_134835

Scaffold Ga0314858_134835

Overview

Basic Information
Taxon OID	3300033742 Open in IMG/M
Scaffold ID	Ga0314858_134835 Open in IMG/M
Source Dataset Name	Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawater
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	632
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine → Extreme Environments Viral Communities From Various Locations

Source Dataset Sampling Location
Location Name	USA: Alaska
Coordinates	Lat. (^o)	71.2943	Long. (^o)	-156.7153	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F011539	Metagenome	290	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0314858_134835_285_590	F011539	GGAG	MIKQSKQNTGEEKKIIQDYFMDCRFRFQDQYKGKVKLIEKNFPLYAVDKTQVPCLLIMDLITYSEGTMTKEDFKSYKIYVQDVLNGYRPPIKFQVIEGGKK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.