Scaffold Ga0371490_1105913

Overview

Basic Information

• Taxon OID: 3300033561
• Scaffold ID: Ga0371490_1105913
• Source Dataset Name: Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB28FN SIP fraction
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 739
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-15 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil → Lab Enriched Peat Soil Microbial Communities From Two Peatlands Near Ithaca, Ny, United States

Source Dataset Sampling Location

• Location Name: USA: McLean, Ithaca, New York
• Coordinates
  • Lat. (^o): 42.5488
  • Long. (^o): -76.2662
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F037183	Metagenome	168	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0371490_11059132	F037183	N/A	NSLMAETLSLTVELPKELVARVKAAKPSWLIELTDEEYLGHVIARGNFDDYLQQLEDANAAVKKLAADLNLGRKGAATQSRNNKGQRPGSKAGQTQPGEKSATAPVT